Recombinant Human Mitochondrial fission 1 protein (FIS1), partial

Artikelnummer: CSB-EP008684HU
Artikelname: Recombinant Human Mitochondrial fission 1 protein (FIS1), partial
Artikelnummer: CSB-EP008684HU
Hersteller Artikelnummer: CSB-EP008684HU
Alternativnummer: CSB-EP008684HU-1, CSB-EP008684HU-100, CSB-EP008684HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: FIS1 homolog,Tetratricopeptide repeat protein 11
Molekulargewicht: 21.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9Y3D6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.148.
Quelle: E.coli
Expression System: 1-122aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Anwendungsbeschreibung: Research Areas: Cancer