Recombinant Human Mitochondrial fission 1 protein (FIS1), partial

Catalog Number: CSB-EP008684HU
Article Name: Recombinant Human Mitochondrial fission 1 protein (FIS1), partial
Biozol Catalog Number: CSB-EP008684HU
Supplier Catalog Number: CSB-EP008684HU
Alternative Catalog Number: CSB-EP008684HU-1, CSB-EP008684HU-100, CSB-EP008684HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FIS1 homolog,Tetratricopeptide repeat protein 11
Molecular Weight: 21.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9Y3D6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.148.
Source: E.coli
Expression System: 1-122aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Application Notes: Research Areas: Cancer