Recombinant Human Metabotropic glutamate receptor 5 (GRM5), partial

Artikelnummer: CSB-EP009935HUA2
Artikelname: Recombinant Human Metabotropic glutamate receptor 5 (GRM5), partial
Artikelnummer: CSB-EP009935HUA2
Hersteller Artikelnummer: CSB-EP009935HUa2
Alternativnummer: CSB-EP009935HUA2-1, CSB-EP009935HUA2-100, CSB-EP009935HUA2-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 81.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P41594
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.258.
Quelle: E.coli
Expression System: 22-580aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVAC
Anwendungsbeschreibung: Research Areas: Cancer