Recombinant Human Metabotropic glutamate receptor 5 (GRM5), partial

Catalog Number: CSB-EP009935HUA2
Article Name: Recombinant Human Metabotropic glutamate receptor 5 (GRM5), partial
Biozol Catalog Number: CSB-EP009935HUA2
Supplier Catalog Number: CSB-EP009935HUa2
Alternative Catalog Number: CSB-EP009935HUA2-1, CSB-EP009935HUA2-100, CSB-EP009935HUA2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 81.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P41594
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.258.
Source: E.coli
Expression System: 22-580aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVAC
Application Notes: Research Areas: Cancer