Recombinant Human Keratocan (KERA)

Artikelnummer: CSB-EP012149HU
Artikelname: Recombinant Human Keratocan (KERA)
Artikelnummer: CSB-EP012149HU
Hersteller Artikelnummer: CSB-EP012149HU
Alternativnummer: CSB-EP012149HU-1, CSB-EP012149HU-100, CSB-EP012149HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Keratan sulfate proteoglycan keratocan
Molekulargewicht: 45.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O60938
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 21-352aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQLKKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQNNKLVDNAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLT
Anwendungsbeschreibung: Research Areas: Others. Endotoxin: Not test