Recombinant Human Keratocan (KERA)

Catalog Number: CSB-EP012149HU
Article Name: Recombinant Human Keratocan (KERA)
Biozol Catalog Number: CSB-EP012149HU
Supplier Catalog Number: CSB-EP012149HU
Alternative Catalog Number: CSB-EP012149HU-1, CSB-EP012149HU-100, CSB-EP012149HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Keratan sulfate proteoglycan keratocan
Molecular Weight: 45.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O60938
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 21-352aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQLKKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQNNKLVDNAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLT
Application Notes: Research Areas: Others. Endotoxin: Not test