Recombinant Rat Natriuretic peptides B (Nppb)

Artikelnummer: CSB-EP016021RA
Artikelname: Recombinant Rat Natriuretic peptides B (Nppb)
Artikelnummer: CSB-EP016021RA
Hersteller Artikelnummer: CSB-EP016021RA
Alternativnummer: CSB-EP016021RA-1, CSB-EP016021RA-100, CSB-EP016021RA-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Brain natriuretic factor prohormone,Gamma-brain natriuretic peptide,Iso-ANP
Molekulargewicht: 17.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P13205
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.266.
Quelle: E.coli
Expression System: 27-121aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: HPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Anwendungsbeschreibung: Research Areas: Cardiovascular