Recombinant Rat Natriuretic peptides B (Nppb)

Catalog Number: CSB-EP016021RA
Article Name: Recombinant Rat Natriuretic peptides B (Nppb)
Biozol Catalog Number: CSB-EP016021RA
Supplier Catalog Number: CSB-EP016021RA
Alternative Catalog Number: CSB-EP016021RA-1, CSB-EP016021RA-100, CSB-EP016021RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Brain natriuretic factor prohormone,Gamma-brain natriuretic peptide,Iso-ANP
Molecular Weight: 17.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P13205
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.266.
Source: E.coli
Expression System: 27-121aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Application Notes: Research Areas: Cardiovascular