Recombinant Human Ornithine decarboxylase (ODC1)

Artikelnummer: CSB-EP016269HU
Artikelname: Recombinant Human Ornithine decarboxylase (ODC1)
Artikelnummer: CSB-EP016269HU
Hersteller Artikelnummer: CSB-EP016269HU
Alternativnummer: CSB-EP016269HU-1, CSB-EP016269HU-100, CSB-EP016269HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: DCOR_HUMAN, Dodc1, Odc 1, ODC, Odc1, ODC2, Ornithine decarboxylase 1, Ornithine decarboxylase 2, Ornithine decarboxylase, Ornithine decarboxylase structural 1, RNODC
Molekulargewicht: 71.1 kDa
Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
UniProt: P11926
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-461aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVI
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.