Recombinant Human Ornithine decarboxylase (ODC1)

Catalog Number: CSB-EP016269HU
Article Name: Recombinant Human Ornithine decarboxylase (ODC1)
Biozol Catalog Number: CSB-EP016269HU
Supplier Catalog Number: CSB-EP016269HU
Alternative Catalog Number: CSB-EP016269HU-1, CSB-EP016269HU-100, CSB-EP016269HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: DCOR_HUMAN, Dodc1, Odc 1, ODC, Odc1, ODC2, Ornithine decarboxylase 1, Ornithine decarboxylase 2, Ornithine decarboxylase, Ornithine decarboxylase structural 1, RNODC
Molecular Weight: 71.1 kDa
Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
UniProt: P11926
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-461aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVI
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.