Recombinant Human Oncostatin-M (OSM)

Produktübersicht

• Artikelname: Recombinant Human Oncostatin-M (OSM)
• Artikelnummer: CSB-EP017260HU2
• Hersteller Artikelnummer: CSB-EP017260HU2
• Alternativnummer: CSB-EP017260HU2-1, CSB-EP017260HU2-100, CSB-EP017260HU2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: MGC20461, ONCM_HUMAN, Oncostatin M, Oncostatin-M, OSM

Produkteigenschaften

• Molekulargewicht: 49 kDa
• Tag: N-terminal GST-tagged
• UniProt: P13725
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 26-220aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR