Recombinant Human Oncostatin-M (OSM)
Catalog Number:
CSB-EP017260HU2
- Images (0)
| Article Name: | Recombinant Human Oncostatin-M (OSM) |
| Biozol Catalog Number: | CSB-EP017260HU2 |
| Supplier Catalog Number: | CSB-EP017260HU2 |
| Alternative Catalog Number: | CSB-EP017260HU2-1, CSB-EP017260HU2-100, CSB-EP017260HU2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | MGC20461, ONCM_HUMAN, Oncostatin M, Oncostatin-M, OSM |
| Molecular Weight: | 49 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P13725 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 26-220aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR |
Product Guarantee and Expert Support
