Recombinant Human Prolactin-inducible protein (PIP)

Artikelnummer: CSB-EP018020HUC7
Artikelname: Recombinant Human Prolactin-inducible protein (PIP)
Artikelnummer: CSB-EP018020HUC7
Hersteller Artikelnummer: CSB-EP018020HUc7
Alternativnummer: CSB-EP018020HUC7-1, CSB-EP018020HUC7-100, CSB-EP018020HUC7-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Gross cystic disease fluid protein 15,Prolactin-induced protein,Secretory actin-binding protein,gp17
Molekulargewicht: 20.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P12273
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 29-146aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Anwendungsbeschreibung: Research Areas: Signal Transduction. Endotoxin: Not test