Recombinant Human Prolactin-inducible protein (PIP)

Catalog Number: CSB-EP018020HUC7
Article Name: Recombinant Human Prolactin-inducible protein (PIP)
Biozol Catalog Number: CSB-EP018020HUC7
Supplier Catalog Number: CSB-EP018020HUc7
Alternative Catalog Number: CSB-EP018020HUC7-1, CSB-EP018020HUC7-100, CSB-EP018020HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Gross cystic disease fluid protein 15,Prolactin-induced protein,Secretory actin-binding protein,gp17
Molecular Weight: 20.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P12273
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 29-146aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Application Notes: Research Areas: Signal Transduction. Endotoxin: Not test