Recombinant Human Plexin-B1 (PLXNB1), partial
Artikelnummer:
CSB-EP018222HU
- Bilder (0)
| Artikelname: | Recombinant Human Plexin-B1 (PLXNB1), partial |
| Artikelnummer: | CSB-EP018222HU |
| Hersteller Artikelnummer: | CSB-EP018222HU |
| Alternativnummer: | CSB-EP018222HU-1, CSB-EP018222HU-100, CSB-EP018222HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Semaphorin receptor SEP) |
| Molekulargewicht: | 19.9 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | O43157 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 35-150aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | LQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAV |
Produktgarantie und fachkundiger Support
