Recombinant Human Plexin-B1 (PLXNB1), partial
Catalog Number:
CSB-EP018222HU
- Images (0)
| Article Name: | Recombinant Human Plexin-B1 (PLXNB1), partial |
| Biozol Catalog Number: | CSB-EP018222HU |
| Supplier Catalog Number: | CSB-EP018222HU |
| Alternative Catalog Number: | CSB-EP018222HU-1, CSB-EP018222HU-100, CSB-EP018222HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Semaphorin receptor SEP) |
| Molecular Weight: | 19.9 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | O43157 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 35-150aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAV |
Product Guarantee and Expert Support
