Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1)

Produktübersicht

• Artikelname: Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1)
• Artikelnummer: CSB-EP018229MO
• Hersteller Artikelnummer: CSB-EP018229MO
• Alternativnummer: CSB-EP018229MO-1, CSB-EP018229MO-100, CSB-EP018229MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein Noxa (Noxa)

Produkteigenschaften

• Molekulargewicht: 15.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9JM54
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-103aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP018229MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pmaip1.