Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1)

Catalog Number: CSB-EP018229MO
Article Name: Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1)
Biozol Catalog Number: CSB-EP018229MO
Supplier Catalog Number: CSB-EP018229MO
Alternative Catalog Number: CSB-EP018229MO-1, CSB-EP018229MO-100, CSB-EP018229MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Protein Noxa (Noxa)
Molecular Weight: 15.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9JM54
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-103aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP018229MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pmaip1.