Recombinant Mouse Prolyl endopeptidase (Prep)

Artikelnummer: CSB-EP018664MO
Artikelname: Recombinant Mouse Prolyl endopeptidase (Prep)
Artikelnummer: CSB-EP018664MO
Hersteller Artikelnummer: CSB-EP018664MO
Alternativnummer: CSB-EP018664MO-1, CSB-EP018664MO-100, CSB-EP018664MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: PE,Post-proline cleaving enzyme
Molekulargewicht: 87.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9QUR6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-710aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLSFQYPDVYRDETSVQEYHGHKICDPYSWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNTLSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFTCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLCYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.