Recombinant Mouse Prolyl endopeptidase (Prep)

Catalog Number: CSB-EP018664MO
Article Name: Recombinant Mouse Prolyl endopeptidase (Prep)
Biozol Catalog Number: CSB-EP018664MO
Supplier Catalog Number: CSB-EP018664MO
Alternative Catalog Number: CSB-EP018664MO-1, CSB-EP018664MO-100, CSB-EP018664MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: PE,Post-proline cleaving enzyme
Molecular Weight: 87.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9QUR6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-710aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLSFQYPDVYRDETSVQEYHGHKICDPYSWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNTLSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFTCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLCYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.