Recombinant Human Rho-related GTP-binding protein RhoC (RHOC)

Artikelnummer: CSB-EP019687HU
Artikelname: Recombinant Human Rho-related GTP-binding protein RhoC (RHOC)
Artikelnummer: CSB-EP019687HU
Hersteller Artikelnummer: CSB-EP019687HU
Alternativnummer: CSB-EP019687HU-1, CSB-EP019687HU-100, CSB-EP019687HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Rho cDNA clone 9
Molekulargewicht: 28.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08134
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.259.
Quelle: E.coli
Expression System: 1-190aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
Anwendungsbeschreibung: Research Areas: Signal Transduction