Recombinant Human Rho-related GTP-binding protein RhoC (RHOC)

Catalog Number: CSB-EP019687HU
Article Name: Recombinant Human Rho-related GTP-binding protein RhoC (RHOC)
Biozol Catalog Number: CSB-EP019687HU
Supplier Catalog Number: CSB-EP019687HU
Alternative Catalog Number: CSB-EP019687HU-1, CSB-EP019687HU-100, CSB-EP019687HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Rho cDNA clone 9
Molecular Weight: 28.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08134
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.259.
Source: E.coli
Expression System: 1-190aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
Application Notes: Research Areas: Signal Transduction