Recombinant Human Superoxide dismutase [Mn], mitochondrial (SOD2)

Artikelnummer: CSB-EP022398HU
Artikelname: Recombinant Human Superoxide dismutase [Mn], mitochondrial (SOD2)
Artikelnummer: CSB-EP022398HU
Hersteller Artikelnummer: CSB-EP022398HU
Alternativnummer: CSB-EP022398HU-1, CSB-EP022398HU-100, CSB-EP022398HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 29.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P04179
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.150.
Quelle: E.coli
Expression System: 25-222aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Anwendungsbeschreibung: Research Areas: Cancer