Recombinant Human Superoxide dismutase [Mn], mitochondrial (SOD2)

Catalog Number: CSB-EP022398HU
Article Name: Recombinant Human Superoxide dismutase [Mn], mitochondrial (SOD2)
Biozol Catalog Number: CSB-EP022398HU
Supplier Catalog Number: CSB-EP022398HU
Alternative Catalog Number: CSB-EP022398HU-1, CSB-EP022398HU-100, CSB-EP022398HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 29.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P04179
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.150.
Source: E.coli
Expression System: 25-222aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Application Notes: Research Areas: Cancer