Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Tat (tat)

Artikelnummer: CSB-EP300241HKJ
Artikelname: Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Tat (tat)
Artikelnummer: CSB-EP300241HKJ
Hersteller Artikelnummer: CSB-EP300241HKJ
Alternativnummer: CSB-EP300241HKJ-1, CSB-EP300241HKJ-100, CSB-EP300241HKJ-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Transactivating regulatory protein
Molekulargewicht: 16.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P69697
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.205.
Quelle: E.coli
Expression System: 1-86aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQSRGDPTGPKE
Anwendungsbeschreibung: Research Areas: Others