Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Tat (tat)

Catalog Number: CSB-EP300241HKJ
Article Name: Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Tat (tat)
Biozol Catalog Number: CSB-EP300241HKJ
Supplier Catalog Number: CSB-EP300241HKJ
Alternative Catalog Number: CSB-EP300241HKJ-1, CSB-EP300241HKJ-100, CSB-EP300241HKJ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Transactivating regulatory protein
Molecular Weight: 16.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P69697
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.205.
Source: E.coli
Expression System: 1-86aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQSRGDPTGPKE
Application Notes: Research Areas: Others