Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8
Artikelnummer:
CSB-EP320455GAW
- Bilder (0)
| Artikelname: | Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 |
| Artikelnummer: | CSB-EP320455GAW |
| Hersteller Artikelnummer: | CSB-EP320455GAW |
| Alternativnummer: | CSB-EP320455GAW-1, CSB-EP320455GAW-100, CSB-EP320455GAW-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (LZ-8) |
| Molekulargewicht: | 19.8 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P14945 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 2-111aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN |
Produktgarantie und fachkundiger Support
