Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8
Catalog Number:
CSB-EP320455GAW
- Images (0)
| Article Name: | Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 |
| Biozol Catalog Number: | CSB-EP320455GAW |
| Supplier Catalog Number: | CSB-EP320455GAW |
| Alternative Catalog Number: | CSB-EP320455GAW-1, CSB-EP320455GAW-100, CSB-EP320455GAW-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (LZ-8) |
| Molecular Weight: | 19.8 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P14945 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-111aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN |
Product Guarantee and Expert Support
