Recombinant Orthopoxvirus vaccinia Cell surface-binding protein OPG105 (D8L), partial

Artikelnummer: CSB-EP3211GKL1A0
Artikelname: Recombinant Orthopoxvirus vaccinia Cell surface-binding protein OPG105 (D8L), partial
Artikelnummer: CSB-EP3211GKL1A0
Hersteller Artikelnummer: CSB-EP3211GKL1a0
Alternativnummer: CSB-EP3211GKL1A0-1, CSB-EP3211GKL1A0-100, CSB-EP3211GKL1A0-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Carbonic anhydrase homolog
Molekulargewicht: 37.0 kDa
Tag: N-terminal 6xHis-tagged
UniProt: L7QJR5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.155.
Quelle: E.coli
Expression System: 1-261aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLRIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARDNYFMRWL
Anwendungsbeschreibung: Research Areas: Others