Recombinant Orthopoxvirus vaccinia Cell surface-binding protein OPG105 (D8L), partial

Catalog Number: CSB-EP3211GKL1A0
Article Name: Recombinant Orthopoxvirus vaccinia Cell surface-binding protein OPG105 (D8L), partial
Biozol Catalog Number: CSB-EP3211GKL1A0
Supplier Catalog Number: CSB-EP3211GKL1a0
Alternative Catalog Number: CSB-EP3211GKL1A0-1, CSB-EP3211GKL1A0-100, CSB-EP3211GKL1A0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Carbonic anhydrase homolog
Molecular Weight: 37.0 kDa
Tag: N-terminal 6xHis-tagged
UniProt: L7QJR5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.155.
Source: E.coli
Expression System: 1-261aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLRIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARDNYFMRWL
Application Notes: Research Areas: Others