Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial

Artikelnummer: CSB-EP322577SNDA0(F21)
Artikelname: Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial
Artikelnummer: CSB-EP322577SNDA0(F21)
Hersteller Artikelnummer: CSB-EP322577SNDa0(F21)
Alternativnummer: CSB-EP322577SNDA0(F21)-1, CSB-EP322577SNDA0(F21)-100, CSB-EP322577SNDA0(F21)-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 31.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P19909
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.200.
Quelle: E.coli
Expression System: 291-497aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Anwendungsbeschreibung: Research Areas: Others