Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial

Catalog Number: CSB-EP322577SNDA0(F21)
Article Name: Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial
Biozol Catalog Number: CSB-EP322577SNDA0(F21)
Supplier Catalog Number: CSB-EP322577SNDa0(F21)
Alternative Catalog Number: CSB-EP322577SNDA0(F21)-1, CSB-EP322577SNDA0(F21)-100, CSB-EP322577SNDA0(F21)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 31.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P19909
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.200.
Source: E.coli
Expression System: 291-497aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Application Notes: Research Areas: Others