Recombinant Vibrio cholerae serotype O1 Cholera toxin transcriptional activator (toxR), partial

Artikelnummer: CSB-EP322805VEX
Artikelname: Recombinant Vibrio cholerae serotype O1 Cholera toxin transcriptional activator (toxR), partial
Artikelnummer: CSB-EP322805VEX
Hersteller Artikelnummer: CSB-EP322805VEX
Alternativnummer: CSB-EP322805VEX-1, CSB-EP322805VEX-100, CSB-EP322805VEX-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 19.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P15795
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.93.
Quelle: E.coli
Expression System: 19-127aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KFILAEKFTFDPLSNTLIDKEDSEEIIRLGSNESRILWLLAQRPNEVISRNDLHDFVWREQGFEVDDSSLTQAISTLRKMLKDSTKSPQYVKTVPKRGYQLIARVETVE
Anwendungsbeschreibung: Research Areas: Others