Recombinant Vibrio cholerae serotype O1 Cholera toxin transcriptional activator (toxR), partial

Catalog Number: CSB-EP322805VEX
Article Name: Recombinant Vibrio cholerae serotype O1 Cholera toxin transcriptional activator (toxR), partial
Biozol Catalog Number: CSB-EP322805VEX
Supplier Catalog Number: CSB-EP322805VEX
Alternative Catalog Number: CSB-EP322805VEX-1, CSB-EP322805VEX-100, CSB-EP322805VEX-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 19.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P15795
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.93.
Source: E.coli
Expression System: 19-127aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KFILAEKFTFDPLSNTLIDKEDSEEIIRLGSNESRILWLLAQRPNEVISRNDLHDFVWREQGFEVDDSSLTQAISTLRKMLKDSTKSPQYVKTVPKRGYQLIARVETVE
Application Notes: Research Areas: Others