Recombinant Clostridium botulinum D phage Botulinum neurotoxin type D (botD), partial

Produktübersicht

• Artikelname: Recombinant Clostridium botulinum D phage Botulinum neurotoxin type D (botD), partial
• Artikelnummer: CSB-EP323098CLQ
• Hersteller Artikelnummer: CSB-EP323098CLQ
• Alternativnummer: CSB-EP323098CLQ-1, CSB-EP323098CLQ-100, CSB-EP323098CLQ-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Bontoxilysin-D

Produkteigenschaften

• Molekulargewicht: 64.5 kDa
• Tag: N-terminal 6xHis-B2M-tagged
• UniProt: P19321
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-442aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSNPSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYGINIPSDKRIRPQVSE