Recombinant Clostridium botulinum D phage Botulinum neurotoxin type D (botD), partial

Catalog Number: CSB-EP323098CLQ
Article Name: Recombinant Clostridium botulinum D phage Botulinum neurotoxin type D (botD), partial
Biozol Catalog Number: CSB-EP323098CLQ
Supplier Catalog Number: CSB-EP323098CLQ
Alternative Catalog Number: CSB-EP323098CLQ-1, CSB-EP323098CLQ-100, CSB-EP323098CLQ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Bontoxilysin-D
Molecular Weight: 64.5 kDa
Tag: N-terminal 6xHis-B2M-tagged
UniProt: P19321
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-442aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSNPSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYGINIPSDKRIRPQVSE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.