Recombinant Woodchuck hepatitis B virus Protein X (X)

Produktübersicht

• Artikelname: Recombinant Woodchuck hepatitis B virus Protein X (X)
• Artikelnummer: CSB-EP323774WAWC7
• Hersteller Artikelnummer: CSB-EP323774WAWc7
• Alternativnummer: CSB-EP323774WAWC7-1, CSB-EP323774WAWC7-100, CSB-EP323774WAWC7-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: HBx,Peptide X,pX

Produkteigenschaften

• Molekulargewicht: 21.3 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P17401
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-141aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL