Recombinant Woodchuck hepatitis B virus Protein X (X)
Catalog Number:
CSB-EP323774WAWC7
- Images (0)
| Article Name: | Recombinant Woodchuck hepatitis B virus Protein X (X) |
| Biozol Catalog Number: | CSB-EP323774WAWC7 |
| Supplier Catalog Number: | CSB-EP323774WAWc7 |
| Alternative Catalog Number: | CSB-EP323774WAWC7-1, CSB-EP323774WAWC7-100, CSB-EP323774WAWC7-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | HBx,Peptide X,pX |
| Molecular Weight: | 21.3 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P17401 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-141aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL |
Product Guarantee and Expert Support
