Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry2Ab (cry2Ab)

Produktübersicht

• Artikelname: Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry2Ab (cry2Ab)
• Artikelnummer: CSB-EP324157BDC
• Hersteller Artikelnummer: CSB-EP324157BDC
• Alternativnummer: CSB-EP324157BDC-1, CSB-EP324157BDC-100, CSB-EP324157BDC-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 71KDA crystal protein,Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIIA(b)

Produkteigenschaften

• Molekulargewicht: 74.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P21254
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-633aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNSVLNSGRTTICDAYNVAAHDPFSFQHKSLDTVQKEWTEWKKNNHSLYLDPIVGTVASFLLKKVGSLVGKRILSELRNLIFPSGSTNLMQDILRETEKFLNQRLNTDTLARVNAELTGLQANVEEFNRQVDNFLNPNRNAVPLSITSSVNTMQQLFLNRLPQFQMQGYQLLLLPLFAQAANLHLSFIRDVILNADEWGISAATLRTYRDYLKNYTRDYSNYCINTYQSAFKGLNTRLHDMLEFRTYMFLNVFEY