Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry2Ab (cry2Ab)

Catalog Number: CSB-EP324157BDC
Article Name: Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry2Ab (cry2Ab)
Biozol Catalog Number: CSB-EP324157BDC
Supplier Catalog Number: CSB-EP324157BDC
Alternative Catalog Number: CSB-EP324157BDC-1, CSB-EP324157BDC-100, CSB-EP324157BDC-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 71KDA crystal protein,Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIIA(b)
Molecular Weight: 74.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P21254
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-633aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNSVLNSGRTTICDAYNVAAHDPFSFQHKSLDTVQKEWTEWKKNNHSLYLDPIVGTVASFLLKKVGSLVGKRILSELRNLIFPSGSTNLMQDILRETEKFLNQRLNTDTLARVNAELTGLQANVEEFNRQVDNFLNPNRNAVPLSITSSVNTMQQLFLNRLPQFQMQGYQLLLLPLFAQAANLHLSFIRDVILNADEWGISAATLRTYRDYLKNYTRDYSNYCINTYQSAFKGLNTRLHDMLEFRTYMFLNVFEY
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.