Recombinant Macaca fascicularis Hemoglobin subunit alpha-A/Q/R/T

Artikelnummer: CSB-EP325146MOV
Artikelname: Recombinant Macaca fascicularis Hemoglobin subunit alpha-A/Q/R/T
Artikelnummer: CSB-EP325146MOV
Hersteller Artikelnummer: CSB-EP325146MOV
Alternativnummer: CSB-EP325146MOV-1, CSB-EP325146MOV-100, CSB-EP325146MOV-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Alpha-A/Q/R/T-globin,Hemoglobin alpha-A/Q/R/T chain
Molekulargewicht: 22.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P21767
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-141aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.