Recombinant Macaca fascicularis Hemoglobin subunit alpha-A/Q/R/T

Catalog Number: CSB-EP325146MOV
Article Name: Recombinant Macaca fascicularis Hemoglobin subunit alpha-A/Q/R/T
Biozol Catalog Number: CSB-EP325146MOV
Supplier Catalog Number: CSB-EP325146MOV
Alternative Catalog Number: CSB-EP325146MOV-1, CSB-EP325146MOV-100, CSB-EP325146MOV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Alpha-A/Q/R/T-globin,Hemoglobin alpha-A/Q/R/T chain
Molecular Weight: 22.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P21767
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-141aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.