Recombinant Potato leafroll virus Major capsid protein (ORF3)

Artikelnummer: CSB-EP325916PQU
Artikelname: Recombinant Potato leafroll virus Major capsid protein (ORF3)
Artikelnummer: CSB-EP325916PQU
Hersteller Artikelnummer: CSB-EP325916PQU
Alternativnummer: CSB-EP325916PQU-1, CSB-EP325916PQU-100, CSB-EP325916PQU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Coat protein Short name: CP
Molekulargewicht: 27.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P17521
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-208aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK