Recombinant Potato leafroll virus Major capsid protein (ORF3)
Catalog Number:
CSB-EP325916PQU
- Images (0)
| Article Name: | Recombinant Potato leafroll virus Major capsid protein (ORF3) |
| Biozol Catalog Number: | CSB-EP325916PQU |
| Supplier Catalog Number: | CSB-EP325916PQU |
| Alternative Catalog Number: | CSB-EP325916PQU-1, CSB-EP325916PQU-100, CSB-EP325916PQU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Coat protein Short name: CP |
| Molecular Weight: | 27.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P17521 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-208aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK |
Product Guarantee and Expert Support
