Recombinant Aspergillus giganteus Antifungal protein (afp)
Artikelnummer:
CSB-EP325933APN
- Bilder (0)
| Artikelname: | Recombinant Aspergillus giganteus Antifungal protein (afp) |
| Artikelnummer: | CSB-EP325933APN |
| Hersteller Artikelnummer: | CSB-EP325933APN |
| Alternativnummer: | CSB-EP325933APN-1, CSB-EP325933APN-100, CSB-EP325933APN-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | afpAntifungal protein |
| Molekulargewicht: | 19.8 kDa |
| Tag: | N-terminal 6xHis-B2M-tagged |
| UniProt: | P17737 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 44-94aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC |
Produktgarantie und fachkundiger Support
