Recombinant Aspergillus giganteus Antifungal protein (afp)
Catalog Number:
CSB-EP325933APN
- Images (0)
| Article Name: | Recombinant Aspergillus giganteus Antifungal protein (afp) |
| Biozol Catalog Number: | CSB-EP325933APN |
| Supplier Catalog Number: | CSB-EP325933APN |
| Alternative Catalog Number: | CSB-EP325933APN-1, CSB-EP325933APN-100, CSB-EP325933APN-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | afpAntifungal protein |
| Molecular Weight: | 19.8 kDa |
| Tag: | N-terminal 6xHis-B2M-tagged |
| UniProt: | P17737 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 44-94aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC |
Product Guarantee and Expert Support
