Recombinant Saccharomyces cerevisiae 1,3-beta-glucan synthase component FKS1 (FKS1), partial

Artikelnummer: CSB-EP330907SVG1
Artikelname: Recombinant Saccharomyces cerevisiae 1,3-beta-glucan synthase component FKS1 (FKS1), partial
Artikelnummer: CSB-EP330907SVG1
Hersteller Artikelnummer: CSB-EP330907SVG1
Alternativnummer: CSB-EP330907SVG1-1, CSB-EP330907SVG1-100, CSB-EP330907SVG1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: 1,3-beta-D-glucan-UDP glucosyltransferase,Calcineurin dependent protein 1,Calcofluor white hypersensitivity protein 53,Echinocandin target gene protein 1,FK506 sensitivity protein 1,Glucan synthase of cerevisiae protein 1,Papulacandin B resistance protein 1
Molekulargewicht: 82.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P38631
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.222.
Quelle: E.coli
Expression System: 700-1358aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NTIFSVGKSFYLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYKPKVLISQVWNAIIISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRDSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAAYEGNENEAEKEDALKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTI
Anwendungsbeschreibung: Research Areas: Others