Recombinant Saccharomyces cerevisiae 1,3-beta-glucan synthase component FKS1 (FKS1), partial

Catalog Number: CSB-EP330907SVG1
Article Name: Recombinant Saccharomyces cerevisiae 1,3-beta-glucan synthase component FKS1 (FKS1), partial
Biozol Catalog Number: CSB-EP330907SVG1
Supplier Catalog Number: CSB-EP330907SVG1
Alternative Catalog Number: CSB-EP330907SVG1-1, CSB-EP330907SVG1-100, CSB-EP330907SVG1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 1,3-beta-D-glucan-UDP glucosyltransferase,Calcineurin dependent protein 1,Calcofluor white hypersensitivity protein 53,Echinocandin target gene protein 1,FK506 sensitivity protein 1,Glucan synthase of cerevisiae protein 1,Papulacandin B resistance protein 1
Molecular Weight: 82.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P38631
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.222.
Source: E.coli
Expression System: 700-1358aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NTIFSVGKSFYLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYKPKVLISQVWNAIIISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRDSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAAYEGNENEAEKEDALKSQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTI
Application Notes: Research Areas: Others