Recombinant Saccharomyces cerevisiae 12 kDa heat shock protein (HSP12)

Artikelnummer: CSB-EP334937SVG
Artikelname: Recombinant Saccharomyces cerevisiae 12 kDa heat shock protein (HSP12)
Artikelnummer: CSB-EP334937SVG
Hersteller Artikelnummer: CSB-EP334937SVG
Alternativnummer: CSB-EP334937SVG-1, CSB-EP334937SVG-100, CSB-EP334937SVG-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Glucose and lipid-regulated protein
Molekulargewicht: 18.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P22943
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-109aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Anwendungsbeschreibung: Research Areas: Others. Endotoxin: Not test