Recombinant Saccharomyces cerevisiae 12 kDa heat shock protein (HSP12)

Catalog Number: CSB-EP334937SVG
Article Name: Recombinant Saccharomyces cerevisiae 12 kDa heat shock protein (HSP12)
Biozol Catalog Number: CSB-EP334937SVG
Supplier Catalog Number: CSB-EP334937SVG
Alternative Catalog Number: CSB-EP334937SVG-1, CSB-EP334937SVG-100, CSB-EP334937SVG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Glucose and lipid-regulated protein
Molecular Weight: 18.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P22943
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-109aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Application Notes: Research Areas: Others. Endotoxin: Not test